Welcome to BuyYess
Default Language
Spain SpainDutch DutchPortugal Portugal
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Fujifilm Instax Mini 9 Instant Camera, Flamingo Pink
Fujifilm Instax Mini 9 Instant Camera, Flamingo Pink
Fujifilm Instax Mini 9 Instant Camera, Flamingo Pink
Fujifilm Instax Mini 9 Instant Camera, Flamingo Pink
Fujifilm Instax Mini 9 Instant Camera, Flamingo Pink

Fujifilm Instax Mini 9 Instant Camera, Flamingo Pink

Product Code: Cp4acoL
Product Condition: New
$128.88 inc. tax
 Add to Cart
Description
Brand Fujifilm
Film Format Type 10x2
Model Name Instax Mini 9
Exposure Control Type Automatic
Item Dimensions LxWxH 3 x 5 x 5.5 inches
Item Weight 307 Grams
  • New selfie mirror; Auto power off time: 5 minutes; Constant firing flash (automatic light adjustment); Recycle time: 0.2 seconds to 6 seconds (when using new batteries), Effective flash range 0.6 meters to 2.7 meters
  • New macro lens adapter for close ups 35 centimeters to 50 centimeters; Shutter speed: 1/60 seconds
  • Automatic exposure measurement; The camera signals the recommended aperture setting with a flashing LED; This helps capture the perfect photo every time
  • High key mode takes brighter pictures with a soft look perfect for portraits
  • 2 AA batteries; Manual switching system (LED indicator in exposure meter)
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i