Welcome to BuyYess
Default Language
Spain SpainDutch DutchPortugal Portugal
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
HP Wireless Mouse X3000 G2 (28Y30AA, Black)
HP Wireless Mouse X3000 G2 (28Y30AA, Black)
HP Wireless Mouse X3000 G2 (28Y30AA, Black)
HP Wireless Mouse X3000 G2 (28Y30AA, Black)
HP Wireless Mouse X3000 G2 (28Y30AA, Black)

HP Wireless Mouse X3000 G2 (28Y30AA, Black)

Product Code: ler8bNU
Product Condition: New
$65.88 inc. tax
 Add to Cart
Description
Connectivity Technology Wi-Fi, USB
Brand HP
Series X3000 G2
Movement Detection Technology Optical
Color Black
  • Wireless convenience: No more wires with the reliable 2.4 GHz wireless connection
  • Dependable power: Efficient battery life delivers up to 15 months of everyday use
  • Contoured comfort: A contoured shape designed for all-day comfort in either hand
  • Easy storage: The nano receiver conveniently stores inside the mouse for easy portability
  • 3-button navigation: 3 button solution and a built-in scroll wheel for optimized productivity
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i