Welcome to BuyYess
Default Language
Spain SpainDutch DutchPortugal Portugal
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Logitech C922x Pro Stream Webcam – Full 1080p HD Web Camera
Logitech C922x Pro Stream Webcam – Full 1080p HD Web Camera
Logitech C922x Pro Stream Webcam – Full 1080p HD Web Camera
Logitech C922x Pro Stream Webcam – Full 1080p HD Web Camera

Logitech C922x Pro Stream Webcam – Full 1080p HD Web Camera

Product Code: Bj3MWw0
Product Condition: New
$186.99 inc. tax
 Add to Cart
Description
Brand Logitech
Series 960-001176
Special Feature Autofocus
Video Capture Resolution 1080p
Connectivity Technology USB
Has Image Stabilization No
Image Capture Speed 60 fps
Video Capture Format Webcam
Maximum Focal Length 1
Minimum Focal Length 1
  • Web camera specifically designed and optimized for professional quality video streaming on social gaming and entertainment sites like Twitch and YouTube
  • Stream and record vibrant, true to life HD 1080P video at 30Fps/ 720P at 60FPS. Compatibility Windows 7, Windows 8 or Windows 10, macOS X 10.9 or higher, XBox One, Chrome OS, Android v5.0 or above, USB port. FoV: 78 degree
  • Full HD glass lens and premium autofocus deliver razor sharp, clear video in consistent high definition while 2 built in mics capture your voice in rich stereo audio
  • Record clear videos even in dim or poorly backlit settings with automatic light correction. Cable length: 5 feet
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i