Welcome to BuyYess
Default Language
Spain SpainDutch DutchPortugal Portugal
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Skullcandy Dime True Wireless in-Ear Earbuds - True Black
Skullcandy Dime True Wireless in-Ear Earbuds - True Black
Skullcandy Dime True Wireless in-Ear Earbuds - True Black
Skullcandy Dime True Wireless in-Ear Earbuds - True Black
Skullcandy Dime True Wireless in-Ear Earbuds - True Black
Skullcandy Dime True Wireless in-Ear Earbuds - True Black
Skullcandy Dime True Wireless in-Ear Earbuds - True Black

Skullcandy Dime True Wireless in-Ear Earbuds - True Black

Product Code: 5Lez7rP
Product Condition: New
$89.88 inc. tax
 Add to Cart
Description
Brand Skullcandy
Ear Placement In Ear
Color True Black
Connectivity Technology Wireless
Model Name Dime True Wireless

  • 12 hours of battery life
  • Microphone, Call, Track and Volume Control
  • Auto Connect
  • Secure Noise Isolating Fit
  • IPX4 Sweat and Water Resistant
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i