Welcome to BuyYess
Default Language
Spain SpainDutch DutchPortugal Portugal
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Skullcandy Hesh 2 Wireless Over-Ear Headphone - Black
Skullcandy Hesh 2 Wireless Over-Ear Headphone - Black
Skullcandy Hesh 2 Wireless Over-Ear Headphone - Black
Skullcandy Hesh 2 Wireless Over-Ear Headphone - Black
Skullcandy Hesh 2 Wireless Over-Ear Headphone - Black
Skullcandy Hesh 2 Wireless Over-Ear Headphone - Black
Skullcandy Hesh 2 Wireless Over-Ear Headphone - Black

Skullcandy Hesh 2 Wireless Over-Ear Headphone - Black

Product Code: Xz7K1wa
Product Condition: New
$136.99 inc. tax
 Add to Cart
Description
Brand Skullcandy
Color Black
Connectivity Technology Wired
Model Name Hesh 2
Form Factor Over Ear
  • Supreme sound: Hesh 2 Wireless features Supreme Sound technology, producing attacking, powerful bass, warm, natural vocals and precision highs.
  • All-day comfort, everyday strength: Soft synthetic leather ear cushions provide endless comfort for your longest playlists. The flexible headband features a metal understructure that can withstand the punishment of everyday use.
  • Long battery life: The rechargeable battery provides up to 15 hours of music when fully charged. Behind the left ear cup is a micro USB port for charging. An LED indicator will blink red when the battery is at 10%. Fully recharges in just 2.5 hours.
  • Wireless pairing and control: Stream your music from any Bluetooth enabled device. On-board plus and minus buttons let you adjust volume and choose songs. Answer and place calls on hold with the round power button.
  • Back-up Aux cable: If you've transcended the need to sleep and your 15-hour battery needs charging, just plug in the included AUX cord with microphone and remote and never miss a beat.
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i