Welcome to BuyYess
Default Language
Spain SpainDutch DutchPortugal Portugal
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Skullcandy Indy Evo True Wireless In-Ear Earbud - True Black
Skullcandy Indy Evo True Wireless In-Ear Earbud - True Black
Skullcandy Indy Evo True Wireless In-Ear Earbud - True Black
Skullcandy Indy Evo True Wireless In-Ear Earbud - True Black
Skullcandy Indy Evo True Wireless In-Ear Earbud - True Black
Skullcandy Indy Evo True Wireless In-Ear Earbud - True Black
Skullcandy Indy Evo True Wireless In-Ear Earbud - True Black

Skullcandy Indy Evo True Wireless In-Ear Earbud - True Black

Product Code: K1G6SU0
Product Condition: New
$132.88 inc. tax
 Add to Cart
Description
Brand Skullcandy
Ear Placement In Ear
Color True Black
Connectivity Technology Wireless
Model Name Indy Evo
  • 30 Hours Total Battery plus Rapid Charge
  • Full Media Controls on Each Bud, Use Either Bud Solo
  • 3 EQ Modes (Music, Movie, Podcast)
  • IP55 Sweat, Water and Dust Resistant
  • Built-in Tile Technology
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i