Welcome to BuyYess
Default Language
Spain SpainDutch DutchPortugal Portugal
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Sunbeam Hot-2-Trot 800 Watt Compact Non-Stick Soleplate Travel Iron, GCSBTR-100-000,Light Blue
Sunbeam Hot-2-Trot 800 Watt Compact Non-Stick Soleplate Travel Iron, GCSBTR-100-000,Light Blue
Sunbeam Hot-2-Trot 800 Watt Compact Non-Stick Soleplate Travel Iron, GCSBTR-100-000,Light Blue
Sunbeam Hot-2-Trot 800 Watt Compact Non-Stick Soleplate Travel Iron, GCSBTR-100-000,Light Blue
Sunbeam Hot-2-Trot 800 Watt Compact Non-Stick Soleplate Travel Iron, GCSBTR-100-000,Light Blue
Sunbeam Hot-2-Trot 800 Watt Compact Non-Stick Soleplate Travel Iron, GCSBTR-100-000,Light Blue

Sunbeam Hot-2-Trot 800 Watt Compact Non-Stick Soleplate Travel Iron, GCSBTR-100-000,Light Blue

Product Code: sG31J0f
Product Condition: New
$97.99 inc. tax
 Add to Cart
Description
  • Dual Voltage System (240V and 120V)
  • Shot of Steam feature presses out wrinkles and presses in creases
  • Indicator light that lets you know the iron is hot
  • Variable temperature controls heat setting offers flexibility for various fabric types
  • Soft touch handle and dial to provide extra comfort
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i