Welcome to BuyYess
Default Language
Spain SpainDutch DutchPortugal Portugal
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
iPhone 12 13 Fast Charger [Apple MFi Certified]Lightning Cable 20W PD USB C Wall Charger 2-Pack 6FT Fasting Charging Adapter
iPhone 12 13 Fast Charger [Apple MFi Certified]Lightning Cable 20W PD USB C Wall Charger 2-Pack 6FT Fasting Charging Adapter
iPhone 12 13 Fast Charger [Apple MFi Certified]Lightning Cable 20W PD USB C Wall Charger 2-Pack 6FT Fasting Charging Adapter
iPhone 12 13 Fast Charger [Apple MFi Certified]Lightning Cable 20W PD USB C Wall Charger 2-Pack 6FT Fasting Charging Adapter
iPhone 12 13 Fast Charger [Apple MFi Certified]Lightning Cable 20W PD USB C Wall Charger 2-Pack 6FT Fasting Charging Adapter

iPhone 12 13 Fast Charger [Apple MFi Certified]Lightning Cable 20W PD USB C Wall Charger 2-Pack 6FT Fasting Charging Adapter

Product Code: tPRnLK7
Product Condition: New
$71.99 inc. tax
 Add to Cart
Description
  • [Apple Fast Wall Charger]20W PD USB Type C power delivery wall plug, PD adapter 3.0 Quickly Charge USB C port provides Max 20W output power, charge your device up to 3x faster than the original 5 W charger, charging your iPhone up to 50% in just 30 minutes for iPhone Charging, At 3A Maximum, Helps You Work Efficiently.
  • [Apple MFi Certified Lightning Cable]With the Apple MFi Chip, the USB-C to lightning cord equips automatic chip recognition function, full support with iOS versions.20W USB-C Charger Offers Multiple Safeguards Automatically. Multi-Charging Protection Keeps Your Device Safe From Over-Current Over-Voltage Over- Heating & Short-Circuiting.
  • [Applicable Apple Equipment ]Use the official iPhone 12 lightning cable 20W USB C wall charger to access fast-charging for iPhone 13/13pro/12/12 Mini/12 Pro/12 Pro Max/SE 2020/11/11 Pro/11 Pro Max/XS/XS Max/XR/X 8 Plus,iPad,iPad Pro iPad mini iPad Air. This Novobit Power Delivery 3.0 FAST charger also charges for iPhone 7 6 Plus,iPhone 5 5c 5s SE Airpod at an original charging speed.
  • [Safety Efficient Fast Charging] The Power Delivery Wall Charger for iPhone owns a built-in multi-protection system, avoiding over-voltage,over-charge,over-heat, etc. The smart chip including the MFi certified lightning cable match the current required by the Apple device automatically, charges your iPhone/iPad device fast, safely, and steadily. Tangle-free 6 Feet length is convenient for usage while charging and sync at home/office/travel in bed, hotel rooms, and more.
  • [What You Get ]2x 6FT Cable and 2 x USB Wall Charger. We offer 7x24 hours of friendly customer service. If you have any questions, please feel free to contact us.
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i