Welcome to BuyYess
Default Language
Spain SpainDutch DutchPortugal Portugal
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Glorious Model D Gaming Mouse, Glossy White (GD-GWHITE)
Glorious Model D Gaming Mouse, Glossy White (GD-GWHITE)
Glorious Model D Gaming Mouse, Glossy White (GD-GWHITE)
Glorious Model D Gaming Mouse, Glossy White (GD-GWHITE)
Glorious Model D Gaming Mouse, Glossy White (GD-GWHITE)
Glorious Model D Gaming Mouse, Glossy White (GD-GWHITE)
Glorious Model D Gaming Mouse, Glossy White (GD-GWHITE)
Glorious Model D Gaming Mouse, Glossy White (GD-GWHITE)

Glorious Model D Gaming Mouse, Glossy White (GD-GWHITE)

Product Code: Qq23Ei2
Product Condition: New
$119.88 inc. tax
 Add to Cart
Description
  • SIZE & STYLE: Ergonomic ultralight weight gaming mouse ideal for [MEDIUM to LARGE] hands. Built for speed, control, and comfort.
  • ULTRA FLEXIBLE CABLE: Our Braided 'Ascended' Cord is so light it produces a drag-free wireless feel.
  • MOUSE FEET: Our Glorious Skates are 100% pure Virgin PTFE that will glide like blades on ice.
  • E-SPORT CUSTOMIZATION: 6-Step DPI, lighting effects, polling rate, lift-off distance, click/scroll speed, 6 buttons with macro support, and more.
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i