Welcome to BuyYess
Default Language
Spain SpainDutch DutchPortugal Portugal
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
BLACK+DECKER Easy Steam Compact Iron, IR40V , Blue 10.4 x 5.8 inches
BLACK+DECKER Easy Steam Compact Iron, IR40V , Blue 10.4 x 5.8 inches
BLACK+DECKER Easy Steam Compact Iron, IR40V , Blue 10.4 x 5.8 inches
BLACK+DECKER Easy Steam Compact Iron, IR40V , Blue 10.4 x 5.8 inches
BLACK+DECKER Easy Steam Compact Iron, IR40V , Blue 10.4 x 5.8 inches
BLACK+DECKER Easy Steam Compact Iron, IR40V , Blue 10.4 x 5.8 inches
BLACK+DECKER Easy Steam Compact Iron, IR40V , Blue 10.4 x 5.8 inches
BLACK+DECKER Easy Steam Compact Iron, IR40V , Blue 10.4 x 5.8 inches

BLACK+DECKER Easy Steam Compact Iron, IR40V , Blue 10.4 x 5.8 inches

Product Code: IXdcHBd
Product Condition: New
$90.94 inc. tax
 Add to Cart
Description
  • 3-Way Auto Shutoff- Get peace of mind with motion-sensitive technology that automatically shuts off the iron if left inactive on its heel, side or soleplate.Wipe soleplate and outer surfaces with a soft cloth dampened with water
  • Anti-Drip- Engineered to prevent dripping by maintaining water at the proper temperature needed to generate steam. Volts : 120V. Wattage : 1200W
  • TrueGlide Nonstick Soleplate-The enhanced soleplate is designed to glide smoothly across all fabric types for ease of use
  • Spray Mist- This push-button mister helps moisten fabrics to tackle and smooth away deep wrinkles
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i