Welcome to BuyYess
Default Language
Spain SpainDutch DutchPortugal Portugal
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
BLACK+DECKER D3030 Allure Professional Steam Iron, Gray/Blue
BLACK+DECKER D3030 Allure Professional Steam Iron, Gray/Blue
BLACK+DECKER D3030 Allure Professional Steam Iron, Gray/Blue
BLACK+DECKER D3030 Allure Professional Steam Iron, Gray/Blue
BLACK+DECKER D3030 Allure Professional Steam Iron, Gray/Blue
BLACK+DECKER D3030 Allure Professional Steam Iron, Gray/Blue
BLACK+DECKER D3030 Allure Professional Steam Iron, Gray/Blue

BLACK+DECKER D3030 Allure Professional Steam Iron, Gray/Blue

Product Code: 5v51KGI
Product Condition: New
$145.99 inc. tax
 Add to Cart
Description
  • Dynamic Steam Technology - The Allure iron produces over 30% more steam to quickly cut through wrinkles and create long-lasting, crisp results on clothes, linens, and more When compared to Shark GI405 and T-Fal FV4476
  • Auto Clean System - Keep the iron at peak performance with the Auto Clean system, which flushes out mineral deposits
  • Variable Temperature and Steam Controls - Independent steam and temperature controls give you the ability to customize each setting separately for the best results across all fabric types
  • Automatic Shutoff - For added peace of mind, the iron shuts off when left unattended for 30 seconds on its side or soleplate, and after 8 minutes on the heel rest
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i