Welcome to BuyYess
Default Language
Spain SpainDutch DutchPortugal Portugal
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
BLACK+DECKER IR1010 Light 'N Easy Compact Steam Iron, Teal
BLACK+DECKER IR1010 Light 'N Easy Compact Steam Iron, Teal
BLACK+DECKER IR1010 Light 'N Easy Compact Steam Iron, Teal
BLACK+DECKER IR1010 Light 'N Easy Compact Steam Iron, Teal
BLACK+DECKER IR1010 Light 'N Easy Compact Steam Iron, Teal
BLACK+DECKER IR1010 Light 'N Easy Compact Steam Iron, Teal
BLACK+DECKER IR1010 Light 'N Easy Compact Steam Iron, Teal
BLACK+DECKER IR1010 Light 'N Easy Compact Steam Iron, Teal

BLACK+DECKER IR1010 Light 'N Easy Compact Steam Iron, Teal

Product Code: 0GsCZmf
Product Condition: New
$97.99 inc. tax
 Add to Cart
Description
  • SmartSteam Technology - Take the guesswork out of ironing. SmartSteam automatically optimizes the amount of steam based on the temperature you select
  • Anti-Drip - The iron is engineered to prevent dripping by closely regulating water temperatures
  • Spray Mist - The push-button mister helps moisten fabrics to quickly smooth away deep wrinkles
  • Automatic Shutoff - For added peace of mind, the iron shuts off when left unattended for 30 seconds on its side or soleplate, and after 8 minutes on the heel rest
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i