Welcome to BuyYess
Default Language
Spain SpainDutch DutchPortugal Portugal
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Skullcandy Hesh 3 Wireless Over-Ear Headphone -(Olive)
Skullcandy Hesh 3 Wireless Over-Ear Headphone -(Olive)
Skullcandy Hesh 3 Wireless Over-Ear Headphone -(Olive)
Skullcandy Hesh 3 Wireless Over-Ear Headphone -(Olive)

Skullcandy Hesh 3 Wireless Over-Ear Headphone -(Olive)

Product Code: yiRul5c
Product Condition: New
$189.88 inc. tax
 Add to Cart
Description
Hesh 3
Brand Skullcandy
Ear Placement Over Ear
Color Olive
Connectivity Technology Wireless
Model Name Hesh 3
  • Bluetooth wireless technology
  • Rapid Charge: 10 Minutes = 4 Hours; 22 Hours of Total Battery Life
  • Noise isolating fit
  • Microphone, call, track, and volume control
  • Collapsible design

Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i