Welcome to BuyYess
Default Language
Spain SpainDutch DutchPortugal Portugal
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
SanDisk 128GB Ultra Flair USB 3.0 Flash Drive - SDCZ73-128G-G46
SanDisk 128GB Ultra Flair USB 3.0 Flash Drive - SDCZ73-128G-G46
SanDisk 128GB Ultra Flair USB 3.0 Flash Drive - SDCZ73-128G-G46
SanDisk 128GB Ultra Flair USB 3.0 Flash Drive - SDCZ73-128G-G46
SanDisk 128GB Ultra Flair USB 3.0 Flash Drive - SDCZ73-128G-G46

SanDisk 128GB Ultra Flair USB 3.0 Flash Drive - SDCZ73-128G-G46

Product Code: 5ySHiYq
Product Condition: New
$67.99 inc. tax
 Add to Cart
Description
Color Black
Memory Storage Capacity 128 GB
Brand SanDisk
Hardware Interface USB 3.0
Read Speed 150 Megabytes Per Second
  • High-speed USB 3.0 performance of up to 150MB/s(1) [(1) Write to drive up to 15x faster than standard USB 2.0 drives (4MB/s); varies by drive capacity. Up to 150MB/s read speed. USB 3.0 port required. Based on internal testing; performance may be lower depending on host device, usage conditions, and other factors; 1MB=1,000,000 bytes]
  • Transfer a full-length movie in less than 30 seconds(2) [(2) Based on 1.2GB MPEG-4 video transfer with USB 3.0 host device. Results may vary based on host device, file attributes and other factors]
  • Transfer to drive up to 15 times faster than standard USB 2.0 drives(1)
  • Sleek, durable metal casing
  • Easy-to-use password protection for your private files(3) [(3)Password protection uses 128-bit AES encryption and is supported by Windows 7, Windows 8, Windows 10, and Mac OS X v10.9+; Software download required for Mac, visit the SanDisk SecureAccess support page
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i