Welcome to BuyYess
Default Language
Spain SpainDutch DutchPortugal Portugal
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Canon TS3322 Wireless Printer All in One Printers - White
Canon TS3322 Wireless Printer All in One Printers - White
Canon TS3322 Wireless Printer All in One Printers - White
Canon TS3322 Wireless Printer All in One Printers - White
Canon TS3322 Wireless Printer All in One Printers - White

Canon TS3322 Wireless Printer All in One Printers - White

Product Code: yOYwiJO
Product Condition: New
$233.99 inc. tax
 Add to Cart
Description
Brand Pixma
Connectivity Technology Wi-Fi
Compatible Devices Smartphones, Laptops
Printer Output Color
Print media Glossy photo paper
Scanner Type Flatbed
Control Method App
  • WIRELESS CONNECT provides a simple setup process that only takes minutes from your smartphone.
  • Designed for ease of use and simple replacement, the PIXMA TS3320 only needs 2 FINE CARTRIDGES for great print quality.
  • Easily print from any room - from laptops, tablets, and smartphones - with built-in Wi-Fi.
  • Load plain or photo paper with the dedicated REAR PAPER TRAY.
  • Adjust settings on the 1.5" SEGMENT LCD SCREEN and straightforward buttons.
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i