Welcome to BuyYess
Default Language
Spain SpainDutch DutchPortugal Portugal
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Canon CanoScan Lide 300 Scanner , 1.7" x 14.5" x 9.9"
Canon CanoScan Lide 300 Scanner , 1.7" x 14.5" x 9.9"
Canon CanoScan Lide 300 Scanner , 1.7" x 14.5" x 9.9"
Canon CanoScan Lide 300 Scanner , 1.7" x 14.5" x 9.9"
Canon CanoScan Lide 300 Scanner , 1.7" x 14.5" x 9.9"
Canon CanoScan Lide 300 Scanner , 1.7" x 14.5" x 9.9"
Canon CanoScan Lide 300 Scanner , 1.7" x 14.5" x 9.9"

Canon CanoScan Lide 300 Scanner , 1.7" x 14.5" x 9.9"

Product Code: ymZKr2g
Product Condition: New
$217.99 inc. tax
 Add to Cart
Description
Media Type Photo ; Receipt ; Business Card ; Paper
Scanner Type Photo, Document
Brand Canon
Model Name CanoScan
Connectivity Technology USB
Item Dimensions LxWxH 14.5 x 9.9 x 1.7 inches
Resolution 2400
Item Weight 3.6 Pounds
Wattage 4.5 watts
Sheet Size 2400 dots_per_inch
  • Scan documents quickly and easily with fast scanning up to 10 seconds
  • Digitize documents and images thanks to 2400 x 2400 dpi resolution, and with image enhancements, such as fade correction and dust reduction, your photos will continue to look great
  • Enjoy ease of use with 4 'EZ' buttons. With auto scan mode, the Scanner automatically detects what you're scanning; Built in PDF button, easily scans and saves pdf's that are editable and searchable
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i