Welcome to BuyYess
Default Language
Spain SpainDutch DutchPortugal Portugal
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Epson FastFoto FF-680W Wireless High-Speed Photo and Document Scanning System, Scanner , Black
Epson FastFoto FF-680W Wireless High-Speed Photo and Document Scanning System, Scanner , Black
Epson FastFoto FF-680W Wireless High-Speed Photo and Document Scanning System, Scanner , Black

Epson FastFoto FF-680W Wireless High-Speed Photo and Document Scanning System, Scanner , Black

Product Code: PC37MTC
Product Condition: New
$918.74 inc. tax
 Add to Cart
Description
Media Type Receipt, Post Card, Photo
Scanner Type Photo, Document
Brand Epson
Connectivity Technology Wi-Fi
Item Dimensions LxWxH 6.7 x 11.7 x 6.9 inches
Resolution 1200
Item Weight 8.2 Pounds
Sheet Size Letter
  • World’s Fastest Personal Photo Scanner (1) — scan thousands of photos as fast as 1 photo per second at 300 dpi (2); batch-scan up to 36 photos at a time
  • Preserve Your Priceless Photos — restore, organize, protect and share photos; scan Polaroid photos, panoramas, postcards and photos up to 8" x 10"
  • Share Stories for Future Generations — use the Epson FastFoto app (3) to add voice and text over your photos or create slideshows, right from your smartphone
  • Perfect Picture Imaging System — bring new life to old photos with auto enhancement, color restoration, red-eye reduction, de-skew, crop and rotate
  • Single-step Technology — capture both the image and any handwritten notes on the back of a photo in a single scan
  • Flexible Scanning — offers a variety of format options for easy sharing (300 dpi), archiving (600 dpi TIFF) and enlarging (1200 dpi (4)); handles multiple sizes in one batch; mobile (up to 600 dpi JPEG)
  • Powerful Document Scanning — includes Epson ScanSmart software with optical character recognition (OCR), which converts scanned images into readable text; scan documents up to 240"; scan speeds up to 45 ppm/90 ipm (5)
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i