Welcome to BuyYess
Default Language
Spain SpainDutch DutchPortugal Portugal
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Canon P-208II ImageFORMULA Personal Document Scanner , Black
Canon P-208II ImageFORMULA Personal Document Scanner , Black
Canon P-208II ImageFORMULA Personal Document Scanner , Black
Canon P-208II ImageFORMULA Personal Document Scanner , Black
Canon P-208II ImageFORMULA Personal Document Scanner , Black
Canon P-208II ImageFORMULA Personal Document Scanner , Black
Canon P-208II ImageFORMULA Personal Document Scanner , Black

Canon P-208II ImageFORMULA Personal Document Scanner , Black

Product Code: hGfI3bx
Product Condition: New
$256.99 inc. tax
 Add to Cart
Description
Media Type Receipt, Paper, Photo, Business Card
Scanner Type Document
Brand Canon
Model Name ImageFORMULA
Connectivity Technology USB
Item Dimensions LxWxH 15.25 x 5.75 x 4.75 inches
Resolution 600
Item Weight 1.3 Pounds
Wattage 2.5 watts
Sheet Size 8.50 x 11, 4 x 6, 2 x 2.80, 8.50 x 14
  • Stay organized: Easily convert your paper documents into digital formats (searchable PDF, JPG, and more) 
  • Convenient and portable: Slim, lightweight and sleek, to fit easily into a briefcase or bag, for use at home or on the road
  • Handles many different document types: Receipts, photos, business cards, long documents, and more
  • Fast and efficient: Scans both sides of a document at the same time, in color, at up to 8 pages-per-minute
  • Broad compatibility: Supports Windows and Mac; TWAIN driver also included
  • Bundled software: Powerful, yet easy-to-use scanning software, as well as a business card organizer
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i