Welcome to BuyYess
Default Language
Spain SpainDutch DutchPortugal Portugal
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
REVLON One-Step Original 1.0 Hair Dryer, Black
REVLON One-Step Original 1.0 Hair Dryer, Black
REVLON One-Step Original 1.0 Hair Dryer, Black
REVLON One-Step Original 1.0 Hair Dryer, Black
REVLON One-Step Original 1.0 Hair Dryer, Black
REVLON One-Step Original 1.0 Hair Dryer, Black
REVLON One-Step Original 1.0 Hair Dryer, Black

REVLON One-Step Original 1.0 Hair Dryer, Black

Product Code: hoWSBTx
Product Condition: New
$90.39 inc. tax
 Add to Cart
Description
Hair Type All
Color Black
Brand REVLON
Material Nylon
Item Dimensions LxWxH 4.1 x 11.4 x 10.1 inches
  • STYLE AND DRY IN ONE STEP: Style, Dry Your Hair in One Step, Max Drying Power with 30% Less Frizz and helps reduce hair damage
  • IONIC plus CERAMIC TECHNOLOGY: Unique Non-Detachable Oval Brush Design for Smoothing the Hair. Designed with Nylon Pin & Tufted Bristles for detangling, improved control
  • STYLING FLEXIBILITY:Speed Settings with Cool option for styling flexibility
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i