Welcome to BuyYess
Default Language
Spain SpainDutch DutchPortugal Portugal
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Caress Body Wash for Women, Daily Silk, 18 oz, 4 Count
Caress Body Wash for Women, Daily Silk, 18 oz, 4 Count
Caress Body Wash for Women, Daily Silk, 18 oz, 4 Count
Caress Body Wash for Women, Daily Silk, 18 oz, 4 Count

Caress Body Wash for Women, Daily Silk, 18 oz, 4 Count

Product Code: 0eXDqAB
Product Condition: New
$50.99 inc. tax
 Add to Cart
Description
Item Form Liquid
Use for Whole Body
Brand Caress
Recommended Uses For Product Body
Scent Orange
  • Caress Daily Silk is a silkening body wash for women infused with the scent of White Peach and Orange Blossom
  • This fragrant body wash is infused with the scent of White Peach and Orange Blossom with a base of sandalwood and musk
  • Caress Daily Silk women's body wash blends rich lather and sophisticated fragrances
  • Lathers beautifully to leave your skin feeling soft and silky all day long unlike normal bath soap
  • All Caress body soap fragrances are crafted by the world's best perfumers
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i