Welcome to BuyYess
Default Language
Spain SpainDutch DutchPortugal Portugal
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
CeraVe Moisturizing Cream | Body and Face Moisturizer for Dry Skin | Body Cream with Hyaluronic Acid and Ceramides | Normal | Fragrance Free | 19 Oz
CeraVe Moisturizing Cream | Body and Face Moisturizer for Dry Skin | Body Cream with Hyaluronic Acid and Ceramides | Normal | Fragrance Free | 19 Oz
CeraVe Moisturizing Cream | Body and Face Moisturizer for Dry Skin | Body Cream with Hyaluronic Acid and Ceramides | Normal | Fragrance Free | 19 Oz
CeraVe Moisturizing Cream | Body and Face Moisturizer for Dry Skin | Body Cream with Hyaluronic Acid and Ceramides | Normal | Fragrance Free | 19 Oz
CeraVe Moisturizing Cream | Body and Face Moisturizer for Dry Skin | Body Cream with Hyaluronic Acid and Ceramides | Normal | Fragrance Free | 19 Oz
CeraVe Moisturizing Cream | Body and Face Moisturizer for Dry Skin | Body Cream with Hyaluronic Acid and Ceramides | Normal | Fragrance Free | 19 Oz
CeraVe Moisturizing Cream | Body and Face Moisturizer for Dry Skin | Body Cream with Hyaluronic Acid and Ceramides | Normal | Fragrance Free | 19 Oz

CeraVe Moisturizing Cream | Body and Face Moisturizer for Dry Skin | Body Cream with Hyaluronic Acid and Ceramides | Normal | Fragrance Free | 19 Oz

Product Code: UIdHbk0
Product Condition: New
$52.99 inc. tax
 Add to Cart
Description
  • [ HYALURONIC ACID MOISTURIZER ] With hyaluronic acid, ceramides and MVE technology for 24 hour hydration. Rich, velvety texture that leaves skin feeling smooth, it is absorbed quickly for softened skin without greasy, sticky, feel.
  • [ ESSENTIAL CERAMIDES ] Ceramides are found naturally in the skin and make up 50% of the lipids in the skin barrier. All CeraVe products are formulated with three essential ceramides (1, 3, 6-II) to help restore and maintain the skin’s natural barrier.
  • [ DRY SKIN RELIEF ] A deficiency of ceramides in skin can often be associated with dry skin, which can feel itchy and look flaky. CeraVe Moisturizing Cream was shown to increase the skin's level of ceramides after 4 weeks.
  • [ DERMATOLOGIST RECOMMENDED ] CeraVe Skincare is developed with dermatologists and has products suitable for dry skin, sensitive skin, oily skin, acne-prone, and more.
  • [ GENTLE DAILY MOISTURIZER ] For face and body or can be used as a hand cream for dry skin relief. Holds National Eczema Association (NEA) Seal of Acceptance. Fragrance free, paraben free, allergy-tested, and non-comedogenic.
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i