Welcome to BuyYess
Default Language
Spain SpainDutch DutchPortugal Portugal
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
CeraVe PM Facial Moisturizing Lotion | Night Cream with Hyaluronic Acid and Niacinamide | Ultra-Lightweight, Oil-Free Moisturizer for Face | 3 Ounce
CeraVe PM Facial Moisturizing Lotion | Night Cream with Hyaluronic Acid and Niacinamide | Ultra-Lightweight, Oil-Free Moisturizer for Face | 3 Ounce
CeraVe PM Facial Moisturizing Lotion | Night Cream with Hyaluronic Acid and Niacinamide | Ultra-Lightweight, Oil-Free Moisturizer for Face | 3 Ounce
CeraVe PM Facial Moisturizing Lotion | Night Cream with Hyaluronic Acid and Niacinamide | Ultra-Lightweight, Oil-Free Moisturizer for Face | 3 Ounce
CeraVe PM Facial Moisturizing Lotion | Night Cream with Hyaluronic Acid and Niacinamide | Ultra-Lightweight, Oil-Free Moisturizer for Face | 3 Ounce

CeraVe PM Facial Moisturizing Lotion | Night Cream with Hyaluronic Acid and Niacinamide | Ultra-Lightweight, Oil-Free Moisturizer for Face | 3 Ounce

Product Code: nN1dUJ0
Product Condition: New
$48.99 inc. tax
 Add to Cart
Description
Special Ingredients Hyaluronic Acid, Niacinamide, Ceramides
Item Form Lotion
Brand CeraVe
Use for Face
Product Benefits Hypoallergenic
  • [ OIL FREE NIGHT LOTION ] Use Cerave PM facial lotion as the last step in an evening skincare routine. If layering with an eye cream, moisturizer or facial serum, apply the Cerave night lotion after other product applications have been fully absorbed
  • [ OVERNIGHT MOISTURIZER ] Cerave’s PM face cream contains niacinamide to help calm the skin and uses MVE Technology to deliver hydration throughout the night. It also contains hyaluronic acid to help retain skin's moisture
  • [ ESSENTIAL CERAMIDES ] Ceramides are found naturally in the skin and make up 50% of the lipids in the skin barrier. All CeraVe products are formulated with three essential ceramides (1, 3, 6-II) to help restore and maintain the skin’s natural barrier
  • [ DERMATOLOGIST RECOMMENDED ] CeraVe Skincare is developed with dermatologists and has products suitable for dry skin, sensitive skin, oily skin, acne-prone, and more
  • [ GENTLE ON SKIN ] Fragrance free, paraben-free, oil free, non-comedogenic, and allergy-tested
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i