Welcome to BuyYess
Default Language
Spain SpainDutch DutchPortugal Portugal
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Curél Extra Dry Skin Therapy Lotion, , Body and Hand Moisturizer, Hydra Silk Hydration with Advanced Ceramide Complex, with Aloe Water, 12 Ounce
Curél Extra Dry Skin Therapy Lotion, , Body and Hand Moisturizer, Hydra Silk Hydration with Advanced Ceramide Complex, with Aloe Water, 12 Ounce
Curél Extra Dry Skin Therapy Lotion, , Body and Hand Moisturizer, Hydra Silk Hydration with Advanced Ceramide Complex, with Aloe Water, 12 Ounce

Curél Extra Dry Skin Therapy Lotion, , Body and Hand Moisturizer, Hydra Silk Hydration with Advanced Ceramide Complex, with Aloe Water, 12 Ounce

Product Code: PCDEWSP
Product Condition: New
$45.99 inc. tax
 Add to Cart
Description
Item Form Liquid
Brand Curel
Use for Hands, Whole Body
Product Benefits Hydrating
Specific Uses For Product Dryness
  • DRY SKIN HEALING - Our Curél Hydra Silk moisturizer transports hydration deep into the surface of skin to help heal dry to extra-day skin. Formulated to be non-irritating.
  • LIGHTWEIGHT MOISTURIZATION - Curél non-greasy moisturizer leaves skin feeling silky and smooth reducing the need to use heavyweight lotions.
  • HYDRATE YOUR SKIN WITH IMMEDIATE ABSORPTION - the unique Curél Aloe Water formulation immediately absorbs within seconds of application.
  • CREATE A MOISTURE BARRIER - Curél moisturizers, with Advanced Ceramide Complex, replenish ceramides to your dry skin. With better moisture retention, you can help prevent the issues associated with extra dry skin.
  • PROVEN DRY SKIN RELIEF – Unique moisturization formulas with a long history of success
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i