Welcome to BuyYess
Default Language
Spain SpainDutch DutchPortugal Portugal
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
FARMASi Double Lash Extend Black Mascara with Eyelash Lengthening Applicator, No Clump Smudge Free Volumizer for Longer, Thicker Lashes, Rotating
FARMASi Double Lash Extend Black Mascara with Eyelash Lengthening Applicator, No Clump Smudge Free Volumizer for Longer, Thicker Lashes, Rotating
FARMASi Double Lash Extend Black Mascara with Eyelash Lengthening Applicator, No Clump Smudge Free Volumizer for Longer, Thicker Lashes, Rotating
FARMASi Double Lash Extend Black Mascara with Eyelash Lengthening Applicator, No Clump Smudge Free Volumizer for Longer, Thicker Lashes, Rotating

FARMASi Double Lash Extend Black Mascara with Eyelash Lengthening Applicator, No Clump Smudge Free Volumizer for Longer, Thicker Lashes, Rotating

Product Code: c5F7oiw
Product Condition: New
$35.92 inc. tax
 Add to Cart
Description
Color Black
Item Volume 12 Milliliters
Brand FARMASi
Unit Count 1.00 Fl Oz
Item Form Liquid
  • Advanced Extension Lash Mascara – Define your look with a premier lash lengthening mascara that helps you create double the volume and length for fuller, healthier-looking lashes that ensure you make a memorable first impression.
  • Innovative Double Application Process – This eyelash mascara utilizes a 2-step process to volumize your lashes to provide an enhanced lengthening effect without a thick, clumpy mess or struggling with magnetic lashes or falsies.
  • Smudge and Flake-Free Wear – Our all-day makeup mascara ensures your natural lashes look absolute stunning all day long. They can stand up to long work days, trips to the gym, and all those fun outdoor activities and adventures this summer.
  • Dramatic Looks without the Fakeness – The real benefit to our eyelash volumizer mascara is that it produces thicker, longer-looking lashes that are 100% you. 
  • Rotating Silicone Applicator Brush – Our black mascara comes with a two-piece rotating silicone brush that helps separate lashes, applies the mascara, and give you more defined look without big, sticky clumps like basic applicator brushes.
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i