Welcome to BuyYess
Default Language
Spain SpainDutch DutchPortugal Portugal
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Finishing Touch Flawless Women's Painless Hair Remover , White/Rose Gold
Finishing Touch Flawless Women's Painless Hair Remover , White/Rose Gold
Finishing Touch Flawless Women's Painless Hair Remover , White/Rose Gold
Finishing Touch Flawless Women's Painless Hair Remover , White/Rose Gold
Finishing Touch Flawless Women's Painless Hair Remover , White/Rose Gold

Finishing Touch Flawless Women's Painless Hair Remover , White/Rose Gold

Product Code: JgWmXTo
Product Condition: New
$54.99 inc. tax
 Add to Cart
Description
Brand Finishing Touch
Color Rose Gold
Power Source Battery Powered
Item Weight 0.17 Pounds
Number of Batteries 1 AA batteries required. (included)
  • Safe on all skin types
  • Dermatologist Approved. It is hypoallergenic, suitable for all women
  • No more cuts from razors
  • No more redness and irritation
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i