Welcome to BuyYess
Default Language
Spain SpainDutch DutchPortugal Portugal
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Gildan Adult Fleece Crewneck Sweatshirt, Style G18000
Gildan Adult Fleece Crewneck Sweatshirt, Style G18000
Gildan Adult Fleece Crewneck Sweatshirt, Style G18000

Gildan Adult Fleece Crewneck Sweatshirt, Style G18000

Product Code: 6vhaweZ
Product Condition: New
$69.97 inc. tax
 Add to Cart
Description
  • 50% Cotton, 50% Polyester
  • Imported
  • Pull On closure
  • Machine Wash
  • Fabric Weight: 8.0 oz/sq.yd.
  • Classic fit
  • Brushed interior provides superior cozy softness
  • Rib cuffs and bottom band with spandex for enhanced stretch and recovery
  • Durable double-needle stitching at shoulders, armholes, neck, waistband, and cuffs
  • Tear away label for customizable comfort
  • Spun air jet yarn delivers a softer feel and reduced pilling
  • DTG, Screen Printing, Embroidery, Heat Transfer, Patches
  • Complete the look with our matching G18100, G18200, and G18300 sweatpants
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i