Welcome to BuyYess
Default Language
Spain SpainDutch DutchPortugal Portugal
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Gildan Men's Heavy Cotton T-Shirt, Style G5000, Multipack
Gildan Men's Heavy Cotton T-Shirt, Style G5000, Multipack
Gildan Men's Heavy Cotton T-Shirt, Style G5000, Multipack
Gildan Men's Heavy Cotton T-Shirt, Style G5000, Multipack
Gildan Men's Heavy Cotton T-Shirt, Style G5000, Multipack

Gildan Men's Heavy Cotton T-Shirt, Style G5000, Multipack

Product Code: Rtk6XMs
Product Condition: New
$65.45 inc. tax
 Add to Cart
Description
  • Imported
  • Pull On closure
  • Machine Wash
  • Fabric Weight: 5.3 oz/sq.yd. 100% Cotton
  • Classic Fit, tubular body
  • Versatile mid-weight fabric for year-round wear
  • Our most popular t-shirt
  • Non-topstitched, classic width, rib collar
  • Companion styles: G5000L, G5000B, G5100P
  • Tear away label for customizable comfort
  • Screen printing, embroidery, iron-on transfers, bleaching and tie dye
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i