Welcome to BuyYess
Default Language
Spain SpainDutch DutchPortugal Portugal
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Jergens Wet Skin Body Moisturizer with Shea Butter Oil, Pure Shea Butter In Shower Lotion, Moisturizer for Dry Skin, Fast-Absorbing, Non-Sticky, 10
Jergens Wet Skin Body Moisturizer with Shea Butter Oil, Pure Shea Butter In Shower Lotion, Moisturizer for Dry Skin, Fast-Absorbing, Non-Sticky, 10
Jergens Wet Skin Body Moisturizer with Shea Butter Oil, Pure Shea Butter In Shower Lotion, Moisturizer for Dry Skin, Fast-Absorbing, Non-Sticky, 10

Jergens Wet Skin Body Moisturizer with Shea Butter Oil, Pure Shea Butter In Shower Lotion, Moisturizer for Dry Skin, Fast-Absorbing, Non-Sticky, 10

Product Code: k85a3JE
Product Condition: New
$43.99 inc. tax
 Add to Cart
Description
Item Form Lotion,Oil
Brand Jergens
Use for Whole Body
Product Benefits Hydrating, Softening
Specific Uses For Product Pores, Dryness
  • IN SHOWER LOTION - Nourishing in shower moisturizer works when skin is most receptive to moisture for luxuriously soft skin that feels renewed and hydrated.
  • LUXURIOUS SKIN RENEWAL - Works when skin is most receptive to moisture for luxuriously soft skin that feels renewed.
  • SHEA OIL DERIVED FROM PURE, AFRICAN SHEA BUTTER - Infused with Shea Butter Oil, this formulas works to restore skin by helping it hold moisture for an enhanced sheen and luminosity.
  • JUST-SHOWERED SKIN BEST ABSORBS MOISTURE - After showering, your pores are open, providing an easy pathway for moisture to absorb into skin.
  • SKIN'S PEAK MOISTURE MOMENT - Absorbs into the skin's surface bringing nourishment and moisturization to the source of dryness.
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i