Welcome to BuyYess
Default Language
Spain SpainDutch DutchPortugal Portugal
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Lee Women’s Instantly Slims Classic Relaxed Fit Monroe Straight Leg Jean
Lee Women’s Instantly Slims Classic Relaxed Fit Monroe Straight Leg Jean
Lee Women’s Instantly Slims Classic Relaxed Fit Monroe Straight Leg Jean

Lee Women’s Instantly Slims Classic Relaxed Fit Monroe Straight Leg Jean

Product Code: jXH4Dzl
Product Condition: New
$86.41 inc. tax
 Add to Cart
Description
  • 81% Cotton, 18% Polyester, 1% Spandex
  • Imported
  • Zipper closure
  • Machine Wash
  • RELAXED FIT. With a loose fit through the hip and thigh, these high-waisted jeans provide all around comfort. Strong stretch fabric helps create a slimming silhouette.
  • CLASSIC 5-POCKET STYLING. A skinny fit jean designed with an authentic five-pocket style. Our bestselling slim fit jean is designed with a timeless five-pocket style, perfect for most occasions.
  • JEANS THAT SLIM. This fabric is designed with comfortable holding power, making them great for any occasion.
  • A LIFETIME OF QUALITY. For over 100 years, Lee has produced quality apparel with durability and long-lasting construction in mind. Lee is committed to designing clothing that conforms to your body, allowing you to move through life freely.
  • SPECIFICATIONS. Zipper fly with button closure, rise: 10.75", leg opening: 15.5", inseam: Short: 29", Medium: 31", Long: 33".
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i