Welcome to BuyYess
Default Language
Spain SpainDutch DutchPortugal Portugal
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
L'Oreal Paris Advanced Hairstyle Lock It Bold Control Hairspray 8.25 Ounce
L'Oreal Paris Advanced Hairstyle Lock It Bold Control Hairspray 8.25 Ounce
L'Oreal Paris Advanced Hairstyle Lock It Bold Control Hairspray 8.25 Ounce

L'Oreal Paris Advanced Hairstyle Lock It Bold Control Hairspray 8.25 Ounce

Product Code: 5sdb7eK
Product Condition: New
$48.99 inc. tax
 Add to Cart
Description
Product Benefits Quick Dry. Humidity Resistant. Heat Protection.
Hair Type Wavy, Curly
Material Type Free Silicone Free
Liquid Volume 8.25 Fluid Ounces
Item Form Spray
  • Humidity-Resistant Hairspray: Lock It Bold Control Anti-Humidity Hairspray goes on evenly and dries quickly to lock in your hairstyle and lock out frizziness all day long; Just spray to set and go, or layer for stronger hold
  • Fine Mist, Strong Hold: Bold Control hair spray goes on in a light fine mist for even coverage and holds your hair style in place for up to 48 hours
  • How will you style it: Whether your style is curly, wavy or straight, this strong hold hairspray holds your look in place for hours, whether you need to slick fly-aways, hold an updo, or preserve your curls
  • L'Oreal Advanced Hair Style: L'Oréal Paris Advanced Hair Style Line gives you high performance products for any style; Whether you are looking to protect hair from heat, hold a style with gel or hairspray
  • Complete The Look: Try with L'Oreal Paris Advanced Hairstyle
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i