Welcome to BuyYess
Default Language
Spain SpainDutch DutchPortugal Portugal
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
L’Oreal Paris Elvive 8 Second Wonder Water Lamellar, Rinse out Moisturizing Hair Treatment for Silky, Shiny Looking Hair, 6.8 FL Oz
L’Oreal Paris Elvive 8 Second Wonder Water Lamellar, Rinse out Moisturizing Hair Treatment for Silky, Shiny Looking Hair, 6.8 FL Oz
L’Oreal Paris Elvive 8 Second Wonder Water Lamellar, Rinse out Moisturizing Hair Treatment for Silky, Shiny Looking Hair, 6.8 FL Oz
L’Oreal Paris Elvive 8 Second Wonder Water Lamellar, Rinse out Moisturizing Hair Treatment for Silky, Shiny Looking Hair, 6.8 FL Oz
L’Oreal Paris Elvive 8 Second Wonder Water Lamellar, Rinse out Moisturizing Hair Treatment for Silky, Shiny Looking Hair, 6.8 FL Oz
L’Oreal Paris Elvive 8 Second Wonder Water Lamellar, Rinse out Moisturizing Hair Treatment for Silky, Shiny Looking Hair, 6.8 FL Oz
L’Oreal Paris Elvive 8 Second Wonder Water Lamellar, Rinse out Moisturizing Hair Treatment for Silky, Shiny Looking Hair, 6.8 FL Oz

L’Oreal Paris Elvive 8 Second Wonder Water Lamellar, Rinse out Moisturizing Hair Treatment for Silky, Shiny Looking Hair, 6.8 FL Oz

Product Code: d38PN0q
Product Condition: New
$48.99 inc. tax
 Add to Cart
Description
Brand L'Oreal Paris
Item Form Liquid
Material Feature Paraben Free
Hair Type Curly,Thick
Product Benefits Moisturizing
  • Try Elvive 8 second wonder water by L'Oreal Paris, This rinse out lamellar moisturizing hair treatment transforms hair in 8 seconds for silkier, shinier, healthier looking hair
  • Breakthrough hair treatment that visibly transforms hair from the first use, 1 Elvive 8 Second Wonder Water sold every minute
  • Silicone-free and paraben-free Elvive 8 Second Wonder Water, Moisturizing agents and amino acid target damaged areas of hair, forming thin layers called lamellas to smooth hair's surface with no weigh-down
  • Breakthrough lamellar water technology, 8 seconds to silkier, shinier, healthier looking hair with a totally weightless feel unlike anything else in hair care; Safe to use on color-treated hair
  • Use 2-3 times per week on wet hair after shampoo, 1 dose for fine to medium textured hair, 2-3 doses for thick to curly textured hair, add 1 more dose if you have long hair; Apply only to lengths, avoiding the scalp
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i