Welcome to BuyYess
Default Language
Spain SpainDutch DutchPortugal Portugal
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
L'Oreal Paris Superior Preference Fade-Defying + Shine Permanent Hair Color, 10NB Ultra Natural Blonde, Pack of 1
L'Oreal Paris Superior Preference Fade-Defying + Shine Permanent Hair Color, 10NB Ultra Natural Blonde, Pack of 1
L'Oreal Paris Superior Preference Fade-Defying + Shine Permanent Hair Color, 10NB Ultra Natural Blonde, Pack of 1
L'Oreal Paris Superior Preference Fade-Defying + Shine Permanent Hair Color, 10NB Ultra Natural Blonde, Pack of 1
L'Oreal Paris Superior Preference Fade-Defying + Shine Permanent Hair Color, 10NB Ultra Natural Blonde, Pack of 1
L'Oreal Paris Superior Preference Fade-Defying + Shine Permanent Hair Color, 10NB Ultra Natural Blonde, Pack of 1
L'Oreal Paris Superior Preference Fade-Defying + Shine Permanent Hair Color, 10NB Ultra Natural Blonde, Pack of 1

L'Oreal Paris Superior Preference Fade-Defying + Shine Permanent Hair Color, 10NB Ultra Natural Blonde, Pack of 1

Product Code: YfzXgPE
Product Condition: New
$49.97 inc. tax
 Add to Cart
Description
Color 10NB Ultra Natural Blonde
Brand L'Oreal Paris
Item Form Gel
Hair Type Normal
  • Superior Preference Permanent Hair Color Kit: For gorgeous, fade-defying hair color with dimension, look no further; We pair our gel hair color formula with Care Supreme Conditioner with Shine Serum to help maintain color vibrancy and provide silk and shine
  • Fade-Defying Hair Color: Superior Preference hair color kits have been our gold standard in hair colors since 1973; There are over 50 shades to choose from, so you can find the perfect shade for you, from luminous red to cool ash blond, to deepest black
  • L'Oreal Permanent Hair Color: L'Oreal Paris Hair Color comes in multiple formulations and styles to deliver long-lasting color, from fade-defying Superior Preference, to bold, stylish Feria, and gray-coverage from Excellence Crème
  • Long Lasting Hair Color: Get beautiful color from L'Oréal Paris hair color; permanent, semi-permanent, temporary hair color, and root cover up; Cover gray hair, highlight, go bold with bright color, or even try an ombre hair color
  • L'Oreal Paris Innovation: We are a total beauty care company that combines the latest in technology with the highest in quality for the ultimate in hair color, hair care, hair style, skin care and cosmetics
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i