Welcome to BuyYess
Default Language
Spain SpainDutch DutchPortugal Portugal
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Maybelline New York Sky High Washable Mascara Makeup, Volumizing Mascara, Buildable, Lengthening Mascara, Defining, Curling, Multiplying
Maybelline New York Sky High Washable Mascara Makeup, Volumizing Mascara, Buildable, Lengthening Mascara, Defining, Curling, Multiplying
Maybelline New York Sky High Washable Mascara Makeup, Volumizing Mascara, Buildable, Lengthening Mascara, Defining, Curling, Multiplying
Maybelline New York Sky High Washable Mascara Makeup, Volumizing Mascara, Buildable, Lengthening Mascara, Defining, Curling, Multiplying
Maybelline New York Sky High Washable Mascara Makeup, Volumizing Mascara, Buildable, Lengthening Mascara, Defining, Curling, Multiplying
Maybelline New York Sky High Washable Mascara Makeup, Volumizing Mascara, Buildable, Lengthening Mascara, Defining, Curling, Multiplying

Maybelline New York Sky High Washable Mascara Makeup, Volumizing Mascara, Buildable, Lengthening Mascara, Defining, Curling, Multiplying

Product Code: kqa7LKe
Product Condition: New
$42.88 inc. tax
 Add to Cart
Description
Color WASHABLE BLACKEST BLACK
Water Resistance Level Waterproof
Product Benefits Defining, Volumizing, Curling, Lengthening
Coverage Full
Item Volume 0.24 Fluid Ounces
  • Sky high lash impact from every angle, full volume meets limitless length
  • Maybelline Lash Sensational Sky High mascara's exclusive flex tower mascara brush bends to volumize and extend every single lash from root to tip
  • This Maybelline volumizing and lengthening mascara formula is infused with bamboo Extract and fibers for long, full lashes that never get weighed down
  • Maybelline mascara is allergy tested, Ophthalmologist tested, suitable for sensitive eyes and contact lens wearers, removes easily with waterproof eye makeup remover
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i