Welcome to BuyYess
Default Language
Spain SpainDutch DutchPortugal Portugal
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Neutrogena Makeup Remover Melting Balm to Oil with Vitamin E, Gentle and Nourishing Makeup Removing Balm for Eye, Lip, or Face Makeup, Travel-Friend
Neutrogena Makeup Remover Melting Balm to Oil with Vitamin E, Gentle and Nourishing Makeup Removing Balm for Eye, Lip, or Face Makeup, Travel-Friend
Neutrogena Makeup Remover Melting Balm to Oil with Vitamin E, Gentle and Nourishing Makeup Removing Balm for Eye, Lip, or Face Makeup, Travel-Friend
Neutrogena Makeup Remover Melting Balm to Oil with Vitamin E, Gentle and Nourishing Makeup Removing Balm for Eye, Lip, or Face Makeup, Travel-Friend
Neutrogena Makeup Remover Melting Balm to Oil with Vitamin E, Gentle and Nourishing Makeup Removing Balm for Eye, Lip, or Face Makeup, Travel-Friend
Neutrogena Makeup Remover Melting Balm to Oil with Vitamin E, Gentle and Nourishing Makeup Removing Balm for Eye, Lip, or Face Makeup, Travel-Friend
Neutrogena Makeup Remover Melting Balm to Oil with Vitamin E, Gentle and Nourishing Makeup Removing Balm for Eye, Lip, or Face Makeup, Travel-Friend
Neutrogena Makeup Remover Melting Balm to Oil with Vitamin E, Gentle and Nourishing Makeup Removing Balm for Eye, Lip, or Face Makeup, Travel-Friend

Neutrogena Makeup Remover Melting Balm to Oil with Vitamin E, Gentle and Nourishing Makeup Removing Balm for Eye, Lip, or Face Makeup, Travel-Friend

Product Code: 1yRRFwC
Product Condition: New
$39.52 inc. tax
 Add to Cart
Description
  • · 2.0 ounces of Neutrogena Makeup Remover Melting Balm to Oil to take off even the most stubborn eye, face or lip makeup
  • · This powerful makeup remover starts as a balm then transforms into a luxurious oil to remove makeup while leaving skin feeling nourished
  • · Balm oil quickly and effectively melts off makeup, helping it seamlessly glide off skin for clean and easy removal
  • · Formulated with vitamin e, so the balm is gentle and nourishing while powerful enough to take off stubborn makeup
  • The travel-friendly packaging makes this makeup removing balm to oil convenient to take on the go in your purse or makeup bag for quick use anywhere
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i