Welcome to BuyYess
Default Language
Spain SpainDutch DutchPortugal Portugal
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Neutrogena Oil-Free Daily Facial Moisturizer for Sensitive Skin, Ultra-Gentle & Lightweight Moisturizers Free of Fragrances
Neutrogena Oil-Free Daily Facial Moisturizer for Sensitive Skin, Ultra-Gentle & Lightweight Moisturizers Free of Fragrances
Neutrogena Oil-Free Daily Facial Moisturizer for Sensitive Skin, Ultra-Gentle & Lightweight Moisturizers Free of Fragrances
Neutrogena Oil-Free Daily Facial Moisturizer for Sensitive Skin, Ultra-Gentle & Lightweight Moisturizers Free of Fragrances
Neutrogena Oil-Free Daily Facial Moisturizer for Sensitive Skin, Ultra-Gentle & Lightweight Moisturizers Free of Fragrances
Neutrogena Oil-Free Daily Facial Moisturizer for Sensitive Skin, Ultra-Gentle & Lightweight Moisturizers Free of Fragrances
Neutrogena Oil-Free Daily Facial Moisturizer for Sensitive Skin, Ultra-Gentle & Lightweight Moisturizers Free of Fragrances
Neutrogena Oil-Free Daily Facial Moisturizer for Sensitive Skin, Ultra-Gentle & Lightweight Moisturizers Free of Fragrances

Neutrogena Oil-Free Daily Facial Moisturizer for Sensitive Skin, Ultra-Gentle & Lightweight Moisturizers Free of Fragrances

Product Code: mo2JRlh
Product Condition: New
$44.99 inc. tax
 Add to Cart
Description
  • 4-fluid ounce bottle of Neutrogena Oil-Free Facial Moisturizer for sensitive skin featuring a lightweight and ultra-gentle formula that hydrates and nourishes skin
  • Oil-free face lotion formula absorbs quickly into skin, eliminating dryness without leaving skin greasy or shiny. It is also non-comedogenic, so it won't clog pores or cause breakouts
  • Clinically proven to provide gentle yet effective moisturization. The water-based moisturizer formula provides optimal hydration that your skin needs to look and feel soft and smooth
  • Gentle daily moisturizer is formulated with glycerin is specially designed for sensitive skin. It features a hypoallergenic formula that is free of fragrances, alcohol, and dyes
  • Apply the lightweight and non-greasy moisturizer all over face and neck. Can be used both morning and night, either alone or under makeup as part of a regular skincare or beauty regimen for an at-home self-care experience
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
write review
Love this lotion.
Thursday, January 25, 2024
I have been using this lotion for years at the advice of my dermatologist. It is nice and smooth not greasy and absorbs beautifully into the skin.
Daisy
Nice cream
Thursday, January 25, 2024
Great product at fair price. Absorbs nicely into skin.
Christina
Great product!
Thursday, January 25, 2024
It's very good and it is also good price
Jennifer. K
Great product. Fast shipping
Thursday, January 25, 2024
I like this product.
Alicia
Good product
Thursday, January 25, 2024
Good product as described.
James Smith
Great face care product
Thursday, January 25, 2024
Works great for oily skin
John Kerry
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i