Welcome to BuyYess
Default Language
Spain SpainDutch DutchPortugal Portugal
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
NIVEA Soft, Refreshingly Soft Moisturizing Cream, 3 Pack
NIVEA Soft, Refreshingly Soft Moisturizing Cream, 3 Pack
NIVEA Soft, Refreshingly Soft Moisturizing Cream, 3 Pack
NIVEA Soft, Refreshingly Soft Moisturizing Cream, 3 Pack

NIVEA Soft, Refreshingly Soft Moisturizing Cream, 3 Pack

Product Code: cPZpY0m
Product Condition: New
$51.99 inc. tax
 Add to Cart
Description
Special Ingredients Jojoba Oil
Item Form Cream
Brand NIVEA
Use for Face
Product Benefits Soothing
  • Body, Face and Hand Cream: An all-in-one body, face cream and hand cream that delivers long-lasting moisture and supple skin
  • Refreshingly Light Formula: This NIVEA moisturizer cream has a refreshingly light formula is enriched with Jojoba Oil and Vitamin E
  • Fast Absorbing: NIVEA Soft moisturizing cream is a fast absorbing body cream for softer, smoother skin without a greasy feel
  • All Skin Types: NIVEA Soft, Refreshingly Soft Moisturizing Cream is perfect for all skin types
  • Includes three (3) 6.8 ounce jars of NIVEA Soft, Refreshingly Soft Moisturizing Cream
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i