Welcome to BuyYess
Default Language
Spain SpainDutch DutchPortugal Portugal
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
NYX Mechanical Eye Pencil, Aqua Green
NYX Mechanical Eye Pencil, Aqua Green
NYX Mechanical Eye Pencil, Aqua Green
NYX Mechanical Eye Pencil, Aqua Green
NYX Mechanical Eye Pencil, Aqua Green

NYX Mechanical Eye Pencil, Aqua Green

Product Code: 6m036ab
Product Condition: New
$35.88 inc. tax
 Add to Cart
Description
Brand NYX PROFESSIONAL MAKEUP
Item Form Pencil
Product Benefits Smoothening
Finish Type Matte
Coverage Full
  • Retractable Eye Liner: A line and defined eye is just a twist away with this eyeliner pen; Intense pigment covers like a liquid eyeliner while its creamy formula holds for hours; No need to sharpen just twist up and apply for a winged out eyeliner look
  • Smudge Proof and Smooth: This smudge proof eyeliner glides on effortlessly and lasts all day through heat and humidity no sad bleeding eyeliner here; Available in natural to bright shades, any eyeliner look is possible with our Retractable Eye Pencil
  • All Eyes On Eye Makeup: Complete your look with our full range of NYX Professional Makeup eye makeup products from eyeshadow palettes to mascara, eyeliners, concealers, setting sprays, and eyebrow products
  • Discover NYX Professional Makeup: Try all of our professional makeup and beauty products today, from eyeshadow, eyeliner, mascara and false lashes to lipstick, foundation, primer, blush, bronzer, brushes and more
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i