Welcome to BuyYess
Default Language
Spain SpainDutch DutchPortugal Portugal
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
NYX PROFESSIONAL MAKEUP HD Studio Photogenic Concealer Wand, Medium Coverage - Alabaster
NYX PROFESSIONAL MAKEUP HD Studio Photogenic Concealer Wand, Medium Coverage - Alabaster
NYX PROFESSIONAL MAKEUP HD Studio Photogenic Concealer Wand, Medium Coverage - Alabaster
NYX PROFESSIONAL MAKEUP HD Studio Photogenic Concealer Wand, Medium Coverage - Alabaster

NYX PROFESSIONAL MAKEUP HD Studio Photogenic Concealer Wand, Medium Coverage - Alabaster

Product Code: fAbNhSX
Product Condition: New
$34.99 inc. tax
 Add to Cart
Description
Color 00 ALABASTER
Brand NYX PROFESSIONAL MAKEUP
Coverage Medium
Skin Tone All
  • HD Photogenic Concealer: This concealer covers blemishes, imperfections, skin discoloration, dark circles under eye, and is safe for all skin types; can also be used as a contouring concealer to sculpt chin and cheekbones
  • Color Correcting Coverage: Available in 23 shades including color correcting green, yellow, and lavender, providing natural to medium coverage on all skin tones and types; Also suitable as a contouring concealer to sculpt chin and cheekbones
  • Face From Foundation To Finish: Complete your makeup look with our full line of NYX Professional Makeup face products to aid in color correction and coverage from blush, bronzer, foundations and contouring concealer to palettes and powders
  • Discover NYX Professional Makeup: Try all of our professional makeup and beauty products today, from eyeshadow, eyeliner, mascara and false lashes to lipstick, foundation, primer, blush, bronzer, brushes and more
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i