Welcome to BuyYess
Default Language
Spain SpainDutch DutchPortugal Portugal
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
NYX PROFESSIONAL MAKEUP Jumbo Eye Pencil, Eyeshadow & Eyeliner Pencil - Milk (Packaging May Vary)
NYX PROFESSIONAL MAKEUP Jumbo Eye Pencil, Eyeshadow & Eyeliner Pencil - Milk (Packaging May Vary)
NYX PROFESSIONAL MAKEUP Jumbo Eye Pencil, Eyeshadow & Eyeliner Pencil - Milk (Packaging May Vary)
NYX PROFESSIONAL MAKEUP Jumbo Eye Pencil, Eyeshadow & Eyeliner Pencil - Milk (Packaging May Vary)

NYX PROFESSIONAL MAKEUP Jumbo Eye Pencil, Eyeshadow & Eyeliner Pencil - Milk (Packaging May Vary)

Product Code: Z1ooo7S
Product Condition: New
$34.99 inc. tax
 Add to Cart
Description
Brand NYX PROFESSIONAL MAKEUP
Item Form Pencil
Product Benefits Smoothening
Finish Type Satin
Coverage Full
  • Eyeliner Crayon: This blendable radiant eyeliner crayon is a total triple threat; Use your Jumbo Eyeliner Pencil as a creamy eyeshadow, eyeliner and highlighter; Apply it to your water lines, inner corners and entire eye lid for a pop of intense color
  • Smooth and Versatile: This creamy eye liner pencil glides on effortlessly, no pulling, tugging or fading; Apply it as an eyeshadow, highlighter, or eyeliner and choose from a rainbow of vivid hues in multiple finishes from matte to metallic
  • All Eyes On Eye Makeup: Complete your look with our full range of NYX Professional Makeup eye makeup products from eyeshadow palettes to mascara, eyeliners, concealers, setting sprays, and eyebrow products
  • Discover NYX Professional Makeup: Try all of our professional makeup and beauty products today, from eyeshadow, eyeliner, mascara and false lashes to lipstick, foundation, primer, blush, bronzer, brushes and more
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i