Welcome to BuyYess
Default Language
Spain SpainDutch DutchPortugal Portugal
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Panasonic Ear and Nose Hair Trimmer for Men with Vacuum Cleaning System, Powerful Motor and Dual-Edge Blades for Smoother Cutting, Wet/Dry – ER-GN70
Panasonic Ear and Nose Hair Trimmer for Men with Vacuum Cleaning System, Powerful Motor and Dual-Edge Blades for Smoother Cutting, Wet/Dry – ER-GN70
Panasonic Ear and Nose Hair Trimmer for Men with Vacuum Cleaning System, Powerful Motor and Dual-Edge Blades for Smoother Cutting, Wet/Dry – ER-GN70
Panasonic Ear and Nose Hair Trimmer for Men with Vacuum Cleaning System, Powerful Motor and Dual-Edge Blades for Smoother Cutting, Wet/Dry – ER-GN70
Panasonic Ear and Nose Hair Trimmer for Men with Vacuum Cleaning System, Powerful Motor and Dual-Edge Blades for Smoother Cutting, Wet/Dry – ER-GN70
Panasonic Ear and Nose Hair Trimmer for Men with Vacuum Cleaning System, Powerful Motor and Dual-Edge Blades for Smoother Cutting, Wet/Dry – ER-GN70
Panasonic Ear and Nose Hair Trimmer for Men with Vacuum Cleaning System, Powerful Motor and Dual-Edge Blades for Smoother Cutting, Wet/Dry – ER-GN70

Panasonic Ear and Nose Hair Trimmer for Men with Vacuum Cleaning System, Powerful Motor and Dual-Edge Blades for Smoother Cutting, Wet/Dry – ER-GN70

Product Code: AN6Tbz2
Product Condition: New
$94.77 inc. tax
 Add to Cart
Description
Recommended Uses For Product Smoother,Ear Hair,Nose,Trimmer
Color Black
Item Weight 0.14 Pounds
Brand Panasonic
Special Feature Vacuum System
  • Smoother Trimming: The most powerful Panasonic nose trimmer yet, the ER-GN70-K uses a high-velocity motor to drives blades effortlessly and smoothly through thick, coarse hair with no pulling or tugging
  • Wet, Dry, and Multi-Use:  Sleek, slim design can be used to trim nose or ear hair, trim brows or trim away stray facial hair. Use the Panasonic nose and ear trimmer for men wet or dry
  • Safe, Efficient Cutting: Innovative dual-edge trimmer blades cut hair at the top and sides for efficient trimming of both longer and shorter hairs; safety cone design keeps skin protected from blades
  • Advanced Micro-Vacuum System: Powerful vacuum collects cut hair for less mess while trimming; run under water to flush out clippings with advanced vortex cleaning system; nose trimmer body rinses clean
  • Ergonomic Design: Angled profile makes it easier to each inside the nose and comfortable to hold; Cordless, battery-operated design provides up to 40 minutes of use (batteries not included)
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i