Welcome to BuyYess
Default Language
Spain SpainDutch DutchPortugal Portugal
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Revlon One-Step Hair Dryer and Styler | Detangle, Dry, and Smooth Hair, (Black)
Revlon One-Step Hair Dryer and Styler | Detangle, Dry, and Smooth Hair, (Black)
Revlon One-Step Hair Dryer and Styler | Detangle, Dry, and Smooth Hair, (Black)
Revlon One-Step Hair Dryer and Styler | Detangle, Dry, and Smooth Hair, (Black)
Revlon One-Step Hair Dryer and Styler | Detangle, Dry, and Smooth Hair, (Black)
Revlon One-Step Hair Dryer and Styler | Detangle, Dry, and Smooth Hair, (Black)

Revlon One-Step Hair Dryer and Styler | Detangle, Dry, and Smooth Hair, (Black)

Product Code: Cp9jCOj
Product Condition: New
$86.88 inc. tax
 Add to Cart
Description
Hair Type All
Color Black
Brand REVLON
Special Feature Lightweight
Item Dimensions LxWxH 4.1 x 11.5 x 10.25 inches
  • ONE-STEP: Revolutionary styling tool that puts the power of a dryer and precision of a styler in your hands.
  • FAST: The large paddle design runs through your hair to detangle, dry, and smooth hair in up to half the time.
  • IONIC TECHNOLOGY: Negative ions saturate the airflow. This helps condition, smooth and make hair shinier, while reducing frizz and static.
  • LIGHTWEIGHT: 1100 watt of drying power. 2 heat/speed settings for styling flexibility with cool option. Professional 6ft swivel cord.
  • PRECISION: Large paddle design and flexible pad dries and smooths hair quickly for added styling comfort.
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i