Welcome to BuyYess
Default Language
Spain SpainDutch DutchPortugal Portugal
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Signature by Levi Strauss & Co. Gold Label Women's Mid Rise Slim Boyfriend Jeans (Standard and Plus)
Signature by Levi Strauss & Co. Gold Label Women's Mid Rise Slim Boyfriend Jeans (Standard and Plus)
Signature by Levi Strauss & Co. Gold Label Women's Mid Rise Slim Boyfriend Jeans (Standard and Plus)
Signature by Levi Strauss & Co. Gold Label Women's Mid Rise Slim Boyfriend Jeans (Standard and Plus)
Signature by Levi Strauss & Co. Gold Label Women's Mid Rise Slim Boyfriend Jeans (Standard and Plus)

Signature by Levi Strauss & Co. Gold Label Women's Mid Rise Slim Boyfriend Jeans (Standard and Plus)

Product Code: KOXfVo6
Product Condition: New
$84.66 inc. tax
 Add to Cart
Description
  • 78% Cotton, 20% Polyester, 2% Elastane
  • Imported
  • Zipper closure
  • Machine Wash
  • Mid Rise
  • 5 Pocket
  • Available in extended sizes
  • Premium quality, super stretchy denim
  • Hugs your curves and keeps its shape all day
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i