Welcome to BuyYess
Default Language
Spain SpainDutch DutchPortugal Portugal
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
SoCozy, Curl Spray LeaveIn Conditioner For Kids Hair Detangles and Restores Curls No Parabens Sulfates Synthetic Colors, Jojoba Oil
SoCozy, Curl Spray LeaveIn Conditioner For Kids Hair Detangles and Restores Curls No Parabens Sulfates Synthetic Colors, Jojoba Oil
SoCozy, Curl Spray LeaveIn Conditioner For Kids Hair Detangles and Restores Curls No Parabens Sulfates Synthetic Colors, Jojoba Oil
SoCozy, Curl Spray LeaveIn Conditioner For Kids Hair Detangles and Restores Curls No Parabens Sulfates Synthetic Colors, Jojoba Oil
SoCozy, Curl Spray LeaveIn Conditioner For Kids Hair Detangles and Restores Curls No Parabens Sulfates Synthetic Colors, Jojoba Oil
SoCozy, Curl Spray LeaveIn Conditioner For Kids Hair Detangles and Restores Curls No Parabens Sulfates Synthetic Colors, Jojoba Oil

SoCozy, Curl Spray LeaveIn Conditioner For Kids Hair Detangles and Restores Curls No Parabens Sulfates Synthetic Colors, Jojoba Oil

Product Code: Q30elur
Product Condition: New
$58.99 inc. tax
 Add to Cart
Description
Brand SoCozy
Item Form Spray
Material Feature Natural, Cruelty Free
Hair Type Curly
Product Benefits Detangling
  • CONDITIONS + CLEANSES: Restores curls natural balance, reduces breakage and improves elasticity
  • KEY INGREDIENTS: Keratin, Plum Seed Oil, Olive Oil
  • SALON FORMULA: SoCozy has over 20 years of experience and expertise about kid's hair.
  • NO NASTY INGREDIENTS: Free from Parabens, Sulfates, Phthalates, Formaldehyde, Synthetic Colors , Propylene Glycol, Gluten, Wheat, and Nuts
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i