Welcome to BuyYess
Default Language
Spain SpainDutch DutchPortugal Portugal
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Soda Women's Topic Open Toe Buckle Ankle Strap Espadrille Synthetic sandals
Soda Women's Topic Open Toe Buckle Ankle Strap Espadrille Synthetic sandals
Soda Women's Topic Open Toe Buckle Ankle Strap Espadrille Synthetic sandals
Soda Women's Topic Open Toe Buckle Ankle Strap Espadrille Synthetic sandals
Soda Women's Topic Open Toe Buckle Ankle Strap Espadrille Synthetic sandals
Soda Women's Topic Open Toe Buckle Ankle Strap Espadrille Synthetic sandals

Soda Women's Topic Open Toe Buckle Ankle Strap Espadrille Synthetic sandals

Product Code: jSNv9NQ
Product Condition: New
$105.99 inc. tax
 Add to Cart
Description
  • Imported
  • manmade sole
  • Platform measures approximately 1.25"
  • Latest Fashion and Trend for Stylish and Sexy look
  • Cute and comfortable Wedge Sandals
  • Ankle Strap Style for easy on/off
  • Fashion Espadrilles Wedge Sandal
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i