Welcome to BuyYess
Default Language
Spain SpainDutch DutchPortugal Portugal
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
STQ Slip On Breathe Mesh Walking Shoes Women Fashion Sneakers Comfort Wedge Platform Loafers
STQ Slip On Breathe Mesh Walking Shoes Women Fashion Sneakers Comfort Wedge Platform Loafers
STQ Slip On Breathe Mesh Walking Shoes Women Fashion Sneakers Comfort Wedge Platform Loafers
STQ Slip On Breathe Mesh Walking Shoes Women Fashion Sneakers Comfort Wedge Platform Loafers
STQ Slip On Breathe Mesh Walking Shoes Women Fashion Sneakers Comfort Wedge Platform Loafers

STQ Slip On Breathe Mesh Walking Shoes Women Fashion Sneakers Comfort Wedge Platform Loafers

Product Code: uJ56wUz
Product Condition: New
$96.99 inc. tax
 Add to Cart
Description
  • Slip-on Design: Slip on design with Elastic Cuff is convenient for user to put on and take off
  • Lightweight: This walking shoes have durable knit upper with good stretch allows the foot to fit perfect, smooth fabric provide great freedom and comfortable
  • Wide Round Toe for All Day Standing: Super lightweight and flexible just like socks, smooth fabric make all your toes comfortable like wearing nothing
  • Great Traction & Shockproof Sole: STQ Thick sole with air cushion helps absorb shock to cushion every stride, and utilizes a rebound sole designed to provide an efficient push-off
  • OCCASION: Fits for long time standing work, walking, casual, floor shoes, plantar fasciitis, nursing, fishing, dress, shopping, travel, driving, jazz, tap dance, street jazz, ballet, athletic and workout
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i