Welcome to BuyYess
Default Language
Spain SpainDutch DutchPortugal Portugal
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Syntech USB C Adapter Pack of 3 Type C to USB A Converter Compatible with iPhone Apple Watch Series, Samsung Galaxy
Syntech USB C Adapter Pack of 3 Type C to USB A Converter Compatible with iPhone Apple Watch Series, Samsung Galaxy
Syntech USB C Adapter Pack of 3 Type C to USB A Converter Compatible with iPhone Apple Watch Series, Samsung Galaxy
Syntech USB C Adapter Pack of 3 Type C to USB A Converter Compatible with iPhone Apple Watch Series, Samsung Galaxy
Syntech USB C Adapter Pack of 3 Type C to USB A Converter Compatible with iPhone Apple Watch Series, Samsung Galaxy
Syntech USB C Adapter Pack of 3 Type C to USB A Converter Compatible with iPhone Apple Watch Series, Samsung Galaxy
Syntech USB C Adapter Pack of 3 Type C to USB A Converter Compatible with iPhone Apple Watch Series, Samsung Galaxy

Syntech USB C Adapter Pack of 3 Type C to USB A Converter Compatible with iPhone Apple Watch Series, Samsung Galaxy

Product Code: y6L4UFY
Product Condition: New
$59.92 inc. tax
 Add to Cart
Description
Connector Type Usb
Brand Syntech
Warranty Type Lifetime
Number of Ports 2
Compatible Devices IPhone 13 12 Pro Max iPad Air 6 Apple Watch Series 7 AirPods 3 Samsung Galaxy
  • Universal Compatibility: Turning USB ports into USB C ports to connect USB C peripherals to devices with USB A ports built in. This enables you to connect phones, tablets, flash drives, mouse, hubs and other USB C peripherals to your laptops and chargers with normal USB
  • Easy to Use: No installation required. Simply plug and work. Super small to stick to USB A ports all the time. This adapter can not transmit any video signals. For example, you can't use it to connect usb c to hdmi adapter.
  • Fast and Stable: Offer USB 2.0 data transfer speed up to 480 Mbps and supports up enough power output for charging. Please be noted: we do not recommend you buy this adapter for Magsafe charger unless your power adapter provides a full 15W power or higher
  • Portable and Compact Design Easy to carry it around and stick on the devices.
  • Durable and Reliable: High quality aluminum case of the adapter has also undergone a fatigue test of bending and has been proven to be suitable for your usage.
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i